Lineage for d1ipaa1 (1ipa A:106-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921214Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546
  6. 2921229Protein RrmA (RrmH), C-terminal domain [75219] (1 species)
    23S rRNA methyltransferase; proposed gene names are as appear in the original publication (and the PDB entry)
  7. 2921230Species Thermus thermophilus [TaxId:274] [75220] (1 PDB entry)
  8. 2921231Domain d1ipaa1: 1ipa A:106-263 [71254]
    Other proteins in same PDB: d1ipaa2

Details for d1ipaa1

PDB Entry: 1ipa (more details), 2.4 Å

PDB Description: crystal structure of rna 2'-o ribose methyltransferase
PDB Compounds: (A:) RNA 2'-o-ribose methyltransferase

SCOPe Domain Sequences for d1ipaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ipaa1 c.116.1.1 (A:106-263) RrmA (RrmH), C-terminal domain {Thermus thermophilus [TaxId: 274]}
tleeyrpspdalilvavglekpgnlgavlrsadaagaeavlvaggvdlyspqvirnstgv
vfslrtlaasesevldwikqhnlplvattphaealyweanlrppvaiavgpeheglraaw
leaaqtqvripmqgqadslnvsvsaalllyealrqrll

SCOPe Domain Coordinates for d1ipaa1:

Click to download the PDB-style file with coordinates for d1ipaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ipaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ipaa2