Lineage for d1ip0a_ (1ip0 A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427874Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 427875Family g.3.11.1: EGF-type module [57197] (21 proteins)
  6. 427880Protein Betacellulin-2 [75670] (1 species)
  7. 427881Species Human (Homo sapiens) [TaxId:9606] [75671] (2 PDB entries)
  8. 427883Domain d1ip0a_: 1ip0 A: [71253]

Details for d1ip0a_

PDB Entry: 1ip0 (more details)

PDB Description: nmr structure of human betacellulin-2

SCOP Domain Sequences for d1ip0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ip0a_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens)}
rkghfsrcpkqykhycikgrcrfvvaeqtpscvcdegyigarcervdlfy

SCOP Domain Coordinates for d1ip0a_:

Click to download the PDB-style file with coordinates for d1ip0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ip0a_: