Lineage for d1ioxa_ (1iox A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889628Protein Betacellulin-2 [75670] (1 species)
  7. 889629Species Human (Homo sapiens) [TaxId:9606] [75671] (2 PDB entries)
  8. 889630Domain d1ioxa_: 1iox A: [71252]

Details for d1ioxa_

PDB Entry: 1iox (more details)

PDB Description: nmr structure of human betacellulin-2
PDB Compounds: (A:) Betacellulin

SCOP Domain Sequences for d1ioxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]}
rkghfsrcpkqykhycikgrcrfvvaeqtpscvcdegyigarcervdlfy

SCOP Domain Coordinates for d1ioxa_:

Click to download the PDB-style file with coordinates for d1ioxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ioxa_: