SCOPe 2.08: Domain d1inqa1: 1inq A:182-275

Lineage for d1inqa1 (1inq A:182-275)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
   Uniprot P01901 22-299

8. Domain d1inqa1: 1inq A:182-275 [71247]
   Other proteins in same PDB: d1inqa2, d1inqb_
   complexed with dms

Details for d1inqa1

PDB Entry: 1inq, 2.2 Å

PDB Description: Structure of Minor Histocompatibility Antigen peptide, H13a, complexed to H2-Db

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1inqa1:

Sequence; same for both SEQRES and ATOM records:

>d1inqa1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwe

Timeline for d1inqa1:

• d1inqa1 first appeared in SCOP 1.61
  
• d1inqa1 appears in SCOPe 2.07