Lineage for d1ilya_ (1ily A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 317197Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 317198Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 317199Protein Ribosomal protein L18 (L18p) [53139] (2 species)
  7. 317213Species Thermus thermophilus [TaxId:274] [75245] (1 PDB entry)
  8. 317214Domain d1ilya_: 1ily A: [71245]

Details for d1ilya_

PDB Entry: 1ily (more details)

PDB Description: solution structure of ribosomal protein l18 of thermus thermophilus

SCOP Domain Sequences for d1ilya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilya_ c.55.4.1 (A:) Ribosomal protein L18 (L18p) {Thermus thermophilus}
rlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvgralaekalalgi
kqvafdrgpykyhgrvkalaegaregglef

SCOP Domain Coordinates for d1ilya_:

Click to download the PDB-style file with coordinates for d1ilya_.
(The format of our PDB-style files is described here.)

Timeline for d1ilya_: