| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
| Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
| Protein Ribosomal protein L18 (L18p) [53139] (2 species) |
| Species Thermus thermophilus [TaxId:274] [75245] (1 PDB entry) |
| Domain d1ilya_: 1ily A: [71245] |
PDB Entry: 1ily (more details)
SCOP Domain Sequences for d1ilya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ilya_ c.55.4.1 (A:) Ribosomal protein L18 (L18p) {Thermus thermophilus}
rlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvgralaekalalgi
kqvafdrgpykyhgrvkalaegaregglef
Timeline for d1ilya_: