Lineage for d1ik0a_ (1ik0 A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily) Superfamily a.26.1: 4-helical cytokines [47266] (3 families) 
Family a.26.1.2: Short-chain cytokines [47286] (10 proteins) 
Protein Interleukin-13 (IL-13) [63532] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63533] (3 PDB entries) 
Domain d1ik0a_: 1ik0 A: [71240]
Details for d1ik0a_
PDB Entry: 1ik0 (more details)
PDB Description: solution structure of human il-13
SCOP Domain Sequences for d1ik0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ik0a_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens)}
mgpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsai
ektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn
SCOP Domain Coordinates for d1ik0a_:
Click to download the PDB-style file with coordinates for d1ik0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ik0a_:
- d1ik0a_ is new in SCOP 1.61
- d1ik0a_ appears in SCOP 1.63
- d1ik0a_ appears in the current release, SCOPe 2.08, called d1ik0a1
View in 3D