Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [55359] (5 PDB entries) |
Domain d1ihyc2: 1ihy C:149-312 [71224] Other proteins in same PDB: d1ihya1, d1ihyb1, d1ihyc1, d1ihyd1 complexed with apr, so4 |
PDB Entry: 1ihy (more details), 3 Å
SCOPe Domain Sequences for d1ihyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihyc2 d.81.1.1 (C:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamktasegplq gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd
Timeline for d1ihyc2: