Lineage for d1ihyc2 (1ihy C:149-312)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414572Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 414573Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 414574Family d.81.1.1: GAPDH-like [55348] (3 proteins)
    has many additional secondary structures
  6. 414598Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 414699Species Lobster (Palinurus versicolor) [55359] (5 PDB entries)
  8. 414712Domain d1ihyc2: 1ihy C:149-312 [71224]
    Other proteins in same PDB: d1ihya1, d1ihyb1, d1ihyc1, d1ihyd1

Details for d1ihyc2

PDB Entry: 1ihy (more details), 3 Å

PDB Description: GAPDH complexed with ADP-ribose

SCOP Domain Sequences for d1ihyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihyc2 d.81.1.1 (C:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamktasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d1ihyc2:

Click to download the PDB-style file with coordinates for d1ihyc2.
(The format of our PDB-style files is described here.)

Timeline for d1ihyc2: