SCOP 1.63: Domain d1ihyc2: 1ihy C:149-312

Lineage for d1ihyc2 (1ihy C:149-312)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (2 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (13 species)

7. Species Lobster (Palinurus versicolor) [55359] (5 PDB entries)

8. Domain d1ihyc2: 1ihy C:149-312 [71224]
   Other proteins in same PDB: d1ihya1, d1ihyb1, d1ihyc1, d1ihyd1

Details for d1ihyc2

PDB Entry: 1ihy, 3 Å

PDB Description: GAPDH complexed with ADP-ribose

SCOP Domain Sequences for d1ihyc2:

Sequence; same for both SEQRES and ATOM records:

>d1ihyc2 d.81.1.1 (C:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamktasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

Timeline for d1ihyc2:

• d1ihyc2 first appeared in SCOP 1.61
  
• d1ihyc2 appears in SCOP 1.65
  
• d1ihyc2 appears in the current release, SCOPe 2.08