![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (4 proteins) has many additional secondary structures |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species) |
![]() | Species Lobster (Palinurus versicolor) [55359] (5 PDB entries) |
![]() | Domain d1ihyb2: 1ihy B:149-312 [71222] Other proteins in same PDB: d1ihya1, d1ihyb1, d1ihyc1, d1ihyd1 |
PDB Entry: 1ihy (more details), 3 Å
SCOP Domain Sequences for d1ihyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihyb2 d.81.1.1 (B:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)} cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamktasegplq gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd
Timeline for d1ihyb2: