Lineage for d1ihxc1 (1ihx C:1-148,C:313-334)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1578283Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1578524Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1578640Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [51811] (5 PDB entries)
  8. 1578649Domain d1ihxc1: 1ihx C:1-148,C:313-334 [71215]
    Other proteins in same PDB: d1ihxa2, d1ihxb2, d1ihxc2, d1ihxd2
    complexed with snd, so4

Details for d1ihxc1

PDB Entry: 1ihx (more details), 2.8 Å

PDB Description: Crystal structure of two D-glyceraldehyde-3-phosphate dehydrogenase complexes: a case of asymmetry
PDB Compounds: (C:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1ihxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihxc1 c.2.1.3 (C:1-148,C:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

SCOPe Domain Coordinates for d1ihxc1:

Click to download the PDB-style file with coordinates for d1ihxc1.
(The format of our PDB-style files is described here.)

Timeline for d1ihxc1: