Lineage for d1ihxa1 (1ihx A:1-148,A:313-334)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175469Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
  6. 175557Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
  7. 175639Species Lobster (Palinurus versicolor) [51811] (5 PDB entries)
  8. 175646Domain d1ihxa1: 1ihx A:1-148,A:313-334 [71211]
    Other proteins in same PDB: d1ihxa2, d1ihxb2, d1ihxc2, d1ihxd2

Details for d1ihxa1

PDB Entry: 1ihx (more details), 2.8 Å

PDB Description: Crystal structure of two D-glyceraldehyde-3-phosphate dehydrogenase complexes: a case of asymmetry

SCOP Domain Sequences for d1ihxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihxa1 c.2.1.3 (A:1-148,A:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

SCOP Domain Coordinates for d1ihxa1:

Click to download the PDB-style file with coordinates for d1ihxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ihxa1: