Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) |
Family b.1.16.1: Lamin A/C globular tail domain [74854] (2 proteins) automatically mapped to Pfam PF00932 |
Protein Lamin A/C globular tail domain [74855] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [74856] (2 PDB entries) |
Domain d1ifra1: 1ifr A:436-544 [71203] Other proteins in same PDB: d1ifra2 complexed with gol |
PDB Entry: 1ifr (more details), 1.4 Å
SCOPe Domain Sequences for d1ifra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ifra1 b.1.16.1 (A:436-544) Lamin A/C globular tail domain {Human (Homo sapiens) [TaxId: 9606]} tsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltyrfppkftlkagqvv tiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklv
Timeline for d1ifra1: