Lineage for d1ifra1 (1ifr A:436-544)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038522Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) (S)
  5. 2038523Family b.1.16.1: Lamin A/C globular tail domain [74854] (2 proteins)
    automatically mapped to Pfam PF00932
  6. 2038524Protein Lamin A/C globular tail domain [74855] (2 species)
  7. 2038525Species Human (Homo sapiens) [TaxId:9606] [74856] (2 PDB entries)
  8. 2038526Domain d1ifra1: 1ifr A:436-544 [71203]
    Other proteins in same PDB: d1ifra2
    complexed with gol

Details for d1ifra1

PDB Entry: 1ifr (more details), 1.4 Å

PDB Description: Structure of Lamin A/C Globular Domain
PDB Compounds: (A:) Lamin A/C

SCOPe Domain Sequences for d1ifra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifra1 b.1.16.1 (A:436-544) Lamin A/C globular tail domain {Human (Homo sapiens) [TaxId: 9606]}
tsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltyrfppkftlkagqvv
tiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklv

SCOPe Domain Coordinates for d1ifra1:

Click to download the PDB-style file with coordinates for d1ifra1.
(The format of our PDB-style files is described here.)

Timeline for d1ifra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ifra2