Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Llama (Lama glama), VH BRUC.D4.4 [74824] (1 PDB entry) |
Domain d1ieha_: 1ieh A: [71199] |
PDB Entry: 1ieh (more details)
SCOP Domain Sequences for d1ieha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ieha_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), VH BRUC.D4.4} dvqlqasggglvqpggslrvscaasgftfssyhmawvrqapgkglewvstinpgdgstyy adsvkgrftisrdnakntlylqmnslksedtavyycakysggaldawgqgtqvtvssqse qkliseedlnhhhhh
Timeline for d1ieha_: