Lineage for d1ieha_ (1ieh A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158548Species Llama (Lama glama), VH BRUC.D4.4 [74824] (1 PDB entry)
  8. 158549Domain d1ieha_: 1ieh A: [71199]

Details for d1ieha_

PDB Entry: 1ieh (more details)

PDB Description: solution structure of a soluble single-domain antibody with hydrophobic residues typical of a vl/vh interface

SCOP Domain Sequences for d1ieha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieha_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), VH BRUC.D4.4}
dvqlqasggglvqpggslrvscaasgftfssyhmawvrqapgkglewvstinpgdgstyy
adsvkgrftisrdnakntlylqmnslksedtavyycakysggaldawgqgtqvtvssqse
qkliseedlnhhhhh

SCOP Domain Coordinates for d1ieha_:

Click to download the PDB-style file with coordinates for d1ieha_.
(The format of our PDB-style files is described here.)

Timeline for d1ieha_: