Lineage for d1i9wa2 (1i9w A:1-292)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340391Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 340392Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) (S)
  5. 340393Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)
  6. 340402Protein Fusion glycoprotein E1 [75656] (1 species)
  7. 340403Species Semliki forest virus [TaxId:11033] [75657] (1 PDB entry)
  8. 340404Domain d1i9wa2: 1i9w A:1-292 [71164]
    Other proteins in same PDB: d1i9wa1

Details for d1i9wa2

PDB Entry: 1i9w (more details), 3 Å

PDB Description: crystal structure of the fusion glycoprotein e1 from semliki forest virus

SCOP Domain Sequences for d1i9wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9wa2 f.10.1.1 (A:1-292) Fusion glycoprotein E1 {Semliki forest virus}
yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive

SCOP Domain Coordinates for d1i9wa2:

Click to download the PDB-style file with coordinates for d1i9wa2.
(The format of our PDB-style files is described here.)

Timeline for d1i9wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i9wa1