Lineage for d1i9wa2 (1i9w A:1-292)
- Root: SCOP 1.63
Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) 
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
2 intertwined domains; all-beta and alpha+betaSuperfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) 
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins) 
Protein Fusion glycoprotein E1 [75656] (1 species) Species Semliki forest virus [TaxId:11033] [75657] (1 PDB entry) 
Domain d1i9wa2: 1i9w A:1-292 [71164]
Other proteins in same PDB: d1i9wa1
Details for d1i9wa2
PDB Entry: 1i9w (more details), 3 Å
PDB Description: crystal structure of the fusion glycoprotein e1 from semliki forest virus
SCOP Domain Sequences for d1i9wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9wa2 f.10.1.1 (A:1-292) Fusion glycoprotein E1 {Semliki forest virus}
yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive
SCOP Domain Coordinates for d1i9wa2:
Click to download the PDB-style file with coordinates for d1i9wa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i9wa2:
- d1i9wa2 first appeared in SCOP 1.61
- d1i9wa2 appears in SCOP 1.65
- d1i9wa2 appears in the current release, SCOPe 2.08
View in 3D
