SCOP 1.67: Domain d1i9wa1: 1i9w A:293-380

Lineage for d1i9wa1 (1i9w A:293-380)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)

6. Protein Fusion glycoprotein E1 [74840] (1 species)

7. Species Semliki forest virus [TaxId:11033] [74841] (2 PDB entries)

8. Domain d1i9wa1: 1i9w A:293-380 [71163]
   Other proteins in same PDB: d1i9wa2

Details for d1i9wa1

PDB Entry: 1i9w, 3 Å

PDB Description: crystal structure of the fusion glycoprotein e1 from semliki forest virus

SCOP Domain Sequences for d1i9wa1:

Sequence, based on SEQRES records:

>d1i9wa1 b.1.18.4 (A:293-380) Fusion glycoprotein E1 {Semliki forest virus}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasc

Sequence, based on observed residues (ATOM records):

>d1i9wa1 b.1.18.4 (A:293-380) Fusion glycoprotein E1 {Semliki forest virus}
aptiidltctvatcthsvltltyktnkngdcsvhshsnvatlqeatakvtlhfstasasp
sfvvslcsaratcsasc

Timeline for d1i9wa1:

• d1i9wa1 first appeared in SCOP 1.61
  
• d1i9wa1 appears in SCOP 1.65
  
• d1i9wa1 appears in SCOP 1.69
  
• d1i9wa1 appears in the current release, SCOPe 2.08