Lineage for d1i9wa1 (1i9w A:293-380)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160736Protein Fusion glycoprotein E1, C-terminal domain [74840] (1 species)
  7. 160737Species Semliki forest virus [TaxId:11033] [74841] (1 PDB entry)
  8. 160738Domain d1i9wa1: 1i9w A:293-380 [71163]
    Other proteins in same PDB: d1i9wa2

Details for d1i9wa1

PDB Entry: 1i9w (more details), 3 Å

PDB Description: crystal structure of the fusion glycoprotein e1 from semliki forest virus

SCOP Domain Sequences for d1i9wa1:

Sequence, based on SEQRES records: (download)

>d1i9wa1 b.1.1.5 (A:293-380) Fusion glycoprotein E1, C-terminal domain {Semliki forest virus}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasc

Sequence, based on observed residues (ATOM records): (download)

>d1i9wa1 b.1.1.5 (A:293-380) Fusion glycoprotein E1, C-terminal domain {Semliki forest virus}
aptiidltctvatcthsvltltyktnkngdcsvhshsnvatlqeatakvtlhfstasasp
sfvvslcsaratcsasc

SCOP Domain Coordinates for d1i9wa1:

Click to download the PDB-style file with coordinates for d1i9wa1.
(The format of our PDB-style files is described here.)

Timeline for d1i9wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i9wa2