Lineage for d1i9rx1 (1i9r X:1-118)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219513Species Fab 5C8 against C40 ligand, (human), kappa L chain [74813] (1 PDB entry)
  8. 219518Domain d1i9rx1: 1i9r X:1-118 [71159]
    Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh2, d1i9rk2, d1i9rl2, d1i9rm2, d1i9rx2, d1i9ry2
    complexed with zn

Details for d1i9rx1

PDB Entry: 1i9r (more details), 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9rx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9rx1 b.1.1.1 (X:1-118) Immunoglobulin (variable domains of L and H chains) {Fab 5C8 against C40 ligand, (human), kappa L chain}
qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf
nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvss

SCOP Domain Coordinates for d1i9rx1:

Click to download the PDB-style file with coordinates for d1i9rx1.
(The format of our PDB-style files is described here.)

Timeline for d1i9rx1: