SCOPe 2.04: Domain d1i9rm2: 1i9r M:112-215

Lineage for d1i9rm2 (1i9r M:112-215)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1i9rm2: 1i9r M:112-215 [71158]
   Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rh2, d1i9rk1, d1i9rk2, d1i9rl1, d1i9rm1, d1i9rx1, d1i9rx2, d1i9ry1
   part of Fab 5C8 against C40 ligand
   complexed with zn

Details for d1i9rm2

PDB Entry: 1i9r, 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

PDB Compounds: (M:) immunoglobulin l

SCOPe Domain Sequences for d1i9rm2:

Sequence; same for both SEQRES and ATOM records:

>d1i9rm2 b.1.1.2 (M:112-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1i9rm2:

• d1i9rm2 first appeared in SCOP 1.61
  
• d1i9rm2 appears in SCOPe 2.03
  
• d1i9rm2 appears in SCOPe 2.05
  
• d1i9rm2 appears in the current release, SCOPe 2.08