Lineage for d1i9rl2 (1i9r L:112-215)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289616Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289696Domain d1i9rl2: 1i9r L:112-215 [71156]
    Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rh2, d1i9rk1, d1i9rk2, d1i9rl1, d1i9rm1, d1i9rx1, d1i9rx2, d1i9ry1

Details for d1i9rl2

PDB Entry: 1i9r (more details), 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9rl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9rl2 b.1.1.2 (L:112-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1i9rl2:

Click to download the PDB-style file with coordinates for d1i9rl2.
(The format of our PDB-style files is described here.)

Timeline for d1i9rl2: