Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab 5C8 against C40 ligand, (human), kappa L chain [74830] (1 PDB entry) |
Domain d1i9rk2: 1i9r K:119-219 [71154] Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rk1, d1i9rl1, d1i9rm1, d1i9rx1, d1i9ry1 |
PDB Entry: 1i9r (more details), 3.1 Å
SCOP Domain Sequences for d1i9rk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9rk2 b.1.1.2 (K:119-219) Immunoglobulin (constant domains of L and H chains) {Fab 5C8 against C40 ligand, (human), kappa L chain} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1i9rk2: