Lineage for d1i9rk1 (1i9r K:1-118)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103465Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 1103556Domain d1i9rk1: 1i9r K:1-118 [71153]
    Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh2, d1i9rk2, d1i9rl1, d1i9rl2, d1i9rm1, d1i9rm2, d1i9rx2, d1i9ry1, d1i9ry2
    complexed with zn

Details for d1i9rk1

PDB Entry: 1i9r (more details), 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody
PDB Compounds: (K:) immunoglobulin h

SCOPe Domain Sequences for d1i9rk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9rk1 b.1.1.1 (K:1-118) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf
nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvss

SCOPe Domain Coordinates for d1i9rk1:

Click to download the PDB-style file with coordinates for d1i9rk1.
(The format of our PDB-style files is described here.)

Timeline for d1i9rk1: