Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1i9rh2: 1i9r H:119-219 [71152] Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rk1, d1i9rl1, d1i9rl2, d1i9rm1, d1i9rm2, d1i9rx1, d1i9ry1, d1i9ry2 |
PDB Entry: 1i9r (more details), 3.1 Å
SCOP Domain Sequences for d1i9rh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9rh2 b.1.1.2 (H:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1i9rh2: