Lineage for d1i9rh1 (1i9r H:1-118)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157947Species Fab 5C8 against C40 ligand, (human), kappa L chain [74813] (1 PDB entry)
  8. 157948Domain d1i9rh1: 1i9r H:1-118 [71151]
    Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh2, d1i9rk2, d1i9rl2, d1i9rm2, d1i9rx2, d1i9ry2

Details for d1i9rh1

PDB Entry: 1i9r (more details), 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9rh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9rh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Fab 5C8 against C40 ligand, (human), kappa L chain}
qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf
nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvss

SCOP Domain Coordinates for d1i9rh1:

Click to download the PDB-style file with coordinates for d1i9rh1.
(The format of our PDB-style files is described here.)

Timeline for d1i9rh1: