Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab 5C8 against C40 ligand, (human), kappa L chain [74813] (1 PDB entry) |
Domain d1i9rh1: 1i9r H:1-118 [71151] Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh2, d1i9rk2, d1i9rl2, d1i9rm2, d1i9rx2, d1i9ry2 |
PDB Entry: 1i9r (more details), 3.1 Å
SCOP Domain Sequences for d1i9rh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9rh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Fab 5C8 against C40 ligand, (human), kappa L chain} qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvss
Timeline for d1i9rh1: