Lineage for d1i9ra_ (1i9r A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555454Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 555455Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 555456Family b.22.1.1: TNF-like [49843] (12 proteins)
  6. 555531Protein Extracellular domain of CD40 ligand [49844] (1 species)
  7. 555532Species Human (Homo sapiens) [TaxId:9606] [49845] (2 PDB entries)
  8. 555534Domain d1i9ra_: 1i9r A: [71148]
    Other proteins in same PDB: d1i9rh1, d1i9rh2, d1i9rk1, d1i9rk2, d1i9rl1, d1i9rl2, d1i9rm1, d1i9rm2, d1i9rx1, d1i9rx2, d1i9ry1, d1i9ry2

Details for d1i9ra_

PDB Entry: 1i9r (more details), 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9ra_ b.22.1.1 (A:) Extracellular domain of CD40 ligand {Human (Homo sapiens)}
npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc
snreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvf
vnvtdpsqvshgtgftsfgllkl

SCOP Domain Coordinates for d1i9ra_:

Click to download the PDB-style file with coordinates for d1i9ra_.
(The format of our PDB-style files is described here.)

Timeline for d1i9ra_: