SCOP 1.61: Domain d1i9jh1: 1i9j H:1-118

Lineage for d1i9jh1 (1i9j H:1-118)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Anti-testosterone Fab, (mouse), kappa L chain [74812] (2 PDB entries)

8. Domain d1i9jh1: 1i9j H:1-118 [71144]
   Other proteins in same PDB: d1i9jh2, d1i9jl2

Details for d1i9jh1

PDB Entry: 1i9j, 2.6 Å

PDB Description: testosterone complex structure of the recombinant monoclonal wild type anti-testosterone fab fragment

SCOP Domain Sequences for d1i9jh1:

Sequence; same for both SEQRES and ATOM records:

>d1i9jh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Anti-testosterone Fab, (mouse), kappa L chain}
evklvesggglvkpggslklscaasgftfstyalswvrqtadkrlewvasivsggntyys
gsvkgrftisrdiarnilylqmsslrsedtamyycareyygyvglaywgqgtlvtvsa

Timeline for d1i9jh1:

• d1i9jh1 is new in SCOP 1.61
  
• d1i9jh1 appears in SCOP 1.63
  
• d1i9jh1 appears in the current release, SCOPe 2.08