Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Anti-testosterone Fab, (mouse), kappa L chain [74812] (2 PDB entries) |
Domain d1i9jh1: 1i9j H:1-118 [71144] Other proteins in same PDB: d1i9jh2, d1i9jl2 |
PDB Entry: 1i9j (more details), 2.6 Å
SCOP Domain Sequences for d1i9jh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9jh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Anti-testosterone Fab, (mouse), kappa L chain} evklvesggglvkpggslklscaasgftfstyalswvrqtadkrlewvasivsggntyys gsvkgrftisrdiarnilylqmsslrsedtamyycareyygyvglaywgqgtlvtvsa
Timeline for d1i9jh1: