Lineage for d1i9il2 (1i9i L:113-219)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159401Species Anti-testosterone Fab, (mouse), kappa L chain [74829] (2 PDB entries)
  8. 159405Domain d1i9il2: 1i9i L:113-219 [71143]
    Other proteins in same PDB: d1i9ih1, d1i9il1

Details for d1i9il2

PDB Entry: 1i9i (more details), 2.72 Å

PDB Description: native crystal structure of the recombinant monoclonal wild type anti-testosterone fab fragment

SCOP Domain Sequences for d1i9il2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9il2 b.1.1.2 (L:113-219) Immunoglobulin (constant domains of L and H chains) {Anti-testosterone Fab, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1i9il2:

Click to download the PDB-style file with coordinates for d1i9il2.
(The format of our PDB-style files is described here.)

Timeline for d1i9il2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i9il1