SCOP 1.67: Domain d1i9il1: 1i9i L:1-112

Lineage for d1i9il1 (1i9i L:1-112)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (121 PDB entries)

8. Domain d1i9il1: 1i9i L:1-112 [71142]
   Other proteins in same PDB: d1i9ih1, d1i9ih2, d1i9il2
   part of anti-testosterone Fab

Details for d1i9il1

PDB Entry: 1i9i, 2.72 Å

PDB Description: native crystal structure of the recombinant monoclonal wild type anti-testosterone fab fragment

SCOP Domain Sequences for d1i9il1:

Sequence; same for both SEQRES and ATOM records:

>d1i9il1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvvtqtplslpvslgdqasiscrssqsivhsngnsylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik

Timeline for d1i9il1:

• d1i9il1 first appeared in SCOP 1.61
  
• d1i9il1 appears in SCOP 1.65
  
• d1i9il1 appears in SCOP 1.69
  
• d1i9il1 appears in the current release, SCOPe 2.08