SCOPe 2.01: Domain d1i9ih1: 1i9i H:1-118

Lineage for d1i9ih1 (1i9i H:1-118)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries)
   Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity

8. Domain d1i9ih1: 1i9i H:1-118 [71140]
   Other proteins in same PDB: d1i9ih2, d1i9il1, d1i9il2
   part of anti-testosterone Fab

Details for d1i9ih1

PDB Entry: 1i9i, 2.72 Å

PDB Description: native crystal structure of the recombinant monoclonal wild type anti-testosterone fab fragment

PDB Compounds: (H:) recombinant monoclonal anti-testosterone fab fragment heavy chain

SCOPe Domain Sequences for d1i9ih1:

Sequence; same for both SEQRES and ATOM records:

>d1i9ih1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
evklvesggglvkpggslklscaasgftfstyalswvrqtadkrlewvasivsggntyys
gsvkgrftisrdiarnilylqmsslrsedtamyycareyygyvglaywgqgtlvtvsa

Timeline for d1i9ih1:

• d1i9ih1 first appeared in SCOP 1.61
  
• d1i9ih1 appears in SCOP 1.75
  
• d1i9ih1 appears in SCOPe 2.02
  
• d1i9ih1 appears in the current release, SCOPe 2.08