SCOPe 2.03: Domain d1i8kb_: 1i8k B:

Lineage for d1i8kb_ (1i8k B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1i8kb_: 1i8k B: [71131]
   Other proteins in same PDB: d1i8ka_
   part of dsFv MR1; complex with a EGFR-VIII peptide
   mutant

Details for d1i8kb_

PDB Entry: 1i8k, 1.8 Å

PDB Description: crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature

PDB Compounds: (B:) epidermal growth factor receptor antibody mr1scfv heavy chain

SCOPe Domain Sequences for d1i8kb_:

Sequence; same for both SEQRES and ATOM records:

>d1i8kb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
qvklqqsggglvkpgaslklscvtsgftfrkfgmswvrqtsdkclewvasistggyntyy
sdnvkgrftisrenakntlylqmsslksedtalyyctrgysstsyamdywgqgttvtvs

Timeline for d1i8kb_:

• d1i8kb_ first appeared in SCOP 1.61
  
• d1i8kb_ appears in SCOPe 2.02
  
• d1i8kb_ appears in SCOPe 2.04
  
• d1i8kb_ appears in the current release, SCOPe 2.08