SCOP 1.67: Domain d1i8ka_: 1i8k A:

Lineage for d1i8ka_ (1i8k A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d1i8ka_: 1i8k A: [71130]
   Other proteins in same PDB: d1i8kb_
   part of dsFv MR1; complex with a EGFR-VIII peptide
   mutant

Details for d1i8ka_

PDB Entry: 1i8k, 1.8 Å

PDB Description: crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature

SCOP Domain Sequences for d1i8ka_:

Sequence; same for both SEQRES and ATOM records:

>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqspaslsvatgekvtircmtstdidddmnwyqqkpgeppkflisegntlrpgvps
rfsssgtgtdfvftientlsedvgdyyclqsfnvpltfgcgtklei

Timeline for d1i8ka_:

• d1i8ka_ first appeared in SCOP 1.61
  
• d1i8ka_ appears in SCOP 1.65
  
• d1i8ka_ appears in SCOP 1.69
  
• d1i8ka_ appears in the current release, SCOPe 2.08