SCOP 1.65: Domain d1i8ib_: 1i8i B:

Lineage for d1i8ib_ (1i8i B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (47 PDB entries)

8. Domain d1i8ib_: 1i8i B: [71129]
   Other proteins in same PDB: d1i8ia_
   part of dsFv MR1; complex with a EGFR-VIII peptide
   mutant

Details for d1i8ib_

PDB Entry: 1i8i, 2.4 Å

PDB Description: crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at room temperature

SCOP Domain Sequences for d1i8ib_:

Sequence; same for both SEQRES and ATOM records:

>d1i8ib_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
qvklqqsggglvkpgaslklscvtsgftfrkfgmswvrqtsdkclewvasistggyntyy
sdnvkgrftisrenakntlylqmsslksedtalyyctrgysstsyamdywgqgttvtvs

Timeline for d1i8ib_:

• d1i8ib_ first appeared in SCOP 1.61
  
• d1i8ib_ appears in SCOP 1.63
  
• d1i8ib_ appears in SCOP 1.67
  
• d1i8ib_ appears in the current release, SCOPe 2.08