Lineage for d1i8ia_ (1i8i A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219372Species dsFv MR1, (mouse), kappa L chain [74811] (2 PDB entries)
  8. 219375Domain d1i8ia_: 1i8i A: [71128]

Details for d1i8ia_

PDB Entry: 1i8i (more details), 2.4 Å

PDB Description: crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at room temperature

SCOP Domain Sequences for d1i8ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8ia_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {dsFv MR1, (mouse), kappa L chain}
dieltqspaslsvatgekvtircmtstdidddmnwyqqkpgeppkflisegntlrpgvps
rfsssgtgtdfvftientlsedvgdyyclqsfnvpltfgcgtklei

SCOP Domain Coordinates for d1i8ia_:

Click to download the PDB-style file with coordinates for d1i8ia_.
(The format of our PDB-style files is described here.)

Timeline for d1i8ia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i8ib_