Lineage for d1i3ca1 (1i3c A:6-147)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855604Protein Response regulator for cyanobacterial phytochrome [75152] (3 species)
  7. 2855611Species Synechocystis sp. PCC 6803, RCP1 [TaxId:1148] [75153] (2 PDB entries)
  8. 2855612Domain d1i3ca1: 1i3c A:6-147 [71112]
    Other proteins in same PDB: d1i3ca2
    complexed with so4

Details for d1i3ca1

PDB Entry: 1i3c (more details), 1.9 Å

PDB Description: response regulator for cyanobacterial phytochrome, rcp1
PDB Compounds: (A:) response regulator rcp1

SCOPe Domain Sequences for d1i3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3ca1 c.23.1.1 (A:6-147) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]}
nppkvillvedskadsrlvqevlktstidheliilrdglaamaflqqqgeyensprpnli
lldlnlpkkdgrevlaeikqnpdlkripvvvlttshneddviasyelhvncyltksrnlk
dlfkmvqgiesfwletvtlpaa

SCOPe Domain Coordinates for d1i3ca1:

Click to download the PDB-style file with coordinates for d1i3ca1.
(The format of our PDB-style files is described here.)

Timeline for d1i3ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i3ca2
View in 3D
Domains from other chains:
(mouse over for more information)
d1i3cb_