Lineage for d1htwb_ (1htw B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394884Family c.37.1.18: YjeE-like [75213] (1 protein)
    mixed beta-sheet; order 234156(0), strands 2 and 6 are antiparallel to the rest
  6. 394885Protein Hypothetical protein HI0065 [75214] (1 species)
  7. 394886Species Haemophilus influenzae [TaxId:727] [75215] (2 PDB entries)
  8. 394888Domain d1htwb_: 1htw B: [71084]

Details for d1htwb_

PDB Entry: 1htw (more details), 1.7 Å

PDB Description: complex of hi0065 with adp and magnesium

SCOP Domain Sequences for d1htwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htwb_ c.37.1.18 (B:) Hypothetical protein HI0065 {Haemophilus influenzae}
mesltqyipdefsmlrfgkkfaeillklhtekaimvylngdlgagkttltrgmlqgighq
gnvksptytlveeyniagkmiyhfdlyrladpeelefmgirdyfntdsicliewsekgqg
ilpeadilvnidyyddarnieliaqtnlgkniisafsn

SCOP Domain Coordinates for d1htwb_:

Click to download the PDB-style file with coordinates for d1htwb_.
(The format of our PDB-style files is described here.)

Timeline for d1htwb_: