Lineage for d1htwb_ (1htw B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870637Family c.37.1.18: YjeE-like [75213] (1 protein)
    mixed beta-sheet; order 234156(0), strands 2 and 6 are antiparallel to the rest
    automatically mapped to Pfam PF02367
  6. 2870638Protein Hypothetical protein HI0065 [75214] (1 species)
  7. 2870639Species Haemophilus influenzae [TaxId:727] [75215] (2 PDB entries)
  8. 2870641Domain d1htwb_: 1htw B: [71084]
    complexed with ADP and magnesium
    complexed with act, adp, mg, na

Details for d1htwb_

PDB Entry: 1htw (more details), 1.7 Å

PDB Description: complex of hi0065 with adp and magnesium
PDB Compounds: (B:) hi0065

SCOPe Domain Sequences for d1htwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htwb_ c.37.1.18 (B:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}
mesltqyipdefsmlrfgkkfaeillklhtekaimvylngdlgagkttltrgmlqgighq
gnvksptytlveeyniagkmiyhfdlyrladpeelefmgirdyfntdsicliewsekgqg
ilpeadilvnidyyddarnieliaqtnlgkniisafsn

SCOPe Domain Coordinates for d1htwb_:

Click to download the PDB-style file with coordinates for d1htwb_.
(The format of our PDB-style files is described here.)

Timeline for d1htwb_: