SCOPe 2.07: Domain d1htwa_: 1htw A:

Lineage for d1htwa_ (1htw A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.18: YjeE-like [75213] (1 protein)
   mixed beta-sheet; order 234156(0), strands 2 and 6 are antiparallel to the rest
   automatically mapped to Pfam PF02367

6. Protein Hypothetical protein HI0065 [75214] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [75215] (2 PDB entries)

8. Domain d1htwa_: 1htw A: [71083]
   complexed with ADP and magnesium
   complexed with act, adp, mg, na

Details for d1htwa_

PDB Entry: 1htw, 1.7 Å

PDB Description: complex of hi0065 with adp and magnesium

PDB Compounds: (A:) hi0065

SCOPe Domain Sequences for d1htwa_:

Sequence; same for both SEQRES and ATOM records:

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}
mesltqyipdefsmlrfgkkfaeillklhtekaimvylngdlgagkttltrgmlqgighq
gnvksptytlveeyniagkmiyhfdlyrladpeelefmgirdyfntdsicliewsekgqg
ilpeadilvnidyyddarnieliaqtnlgkniisafsn

Timeline for d1htwa_:

• d1htwa_ first appeared in SCOP 1.61
  
• d1htwa_ appears in SCOPe 2.06
  
• d1htwa_ appears in the current release, SCOPe 2.08