Lineage for d1htql2 (1htq L:101-468)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1925709Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1925710Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 1925711Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins)
  6. 1925712Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [75542] (2 PDB entries)
  8. 1925725Domain d1htql2: 1htq L:101-468 [71058]
    Other proteins in same PDB: d1htqa1, d1htqb1, d1htqc1, d1htqd1, d1htqe1, d1htqf1, d1htqg1, d1htqh1, d1htqi1, d1htqj1, d1htqk1, d1htql1, d1htqm1, d1htqn1, d1htqo1, d1htqp1, d1htqq1, d1htqr1, d1htqs1, d1htqt1, d1htqu1, d1htqv1, d1htqw1, d1htqx1
    complexed with amp, cit, mn

Details for d1htql2

PDB Entry: 1htq (more details), 2.4 Å

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
PDB Compounds: (L:) glutamine synthetase

SCOPe Domain Sequences for d1htql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htql2 d.128.1.1 (L:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOPe Domain Coordinates for d1htql2:

Click to download the PDB-style file with coordinates for d1htql2.
(The format of our PDB-style files is described here.)

Timeline for d1htql2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htql1
View in 3D
Domains from other chains:
(mouse over for more information)
d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqq1, d1htqq2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2