Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) automatically mapped to Pfam PF03951 |
Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
Domain d1htot1: 1hto T:1-100 [71025] Other proteins in same PDB: d1htoa2, d1htob2, d1htoc2, d1htod2, d1htoe2, d1htof2, d1htog2, d1htoh2, d1htoi2, d1htoj2, d1htok2, d1htol2, d1htom2, d1hton2, d1htoo2, d1htop2, d1htoq2, d1htor2, d1htos2, d1htot2, d1htou2, d1htov2, d1htow2, d1htox2 complexed with amp, cit, mn |
PDB Entry: 1hto (more details), 2.4 Å
SCOPe Domain Sequences for d1htot1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htot1 d.15.9.1 (T:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi hesdmlllpdpetaridpfraaktlninffvhdpftlepy
Timeline for d1htot1:
View in 3D Domains from other chains: (mouse over for more information) d1htoa1, d1htoa2, d1htob1, d1htob2, d1htoc1, d1htoc2, d1htod1, d1htod2, d1htoe1, d1htoe2, d1htof1, d1htof2, d1htog1, d1htog2, d1htoh1, d1htoh2, d1htoi1, d1htoi2, d1htoj1, d1htoj2, d1htok1, d1htok2, d1htol1, d1htol2, d1htom1, d1htom2, d1hton1, d1hton2, d1htoo1, d1htoo2, d1htop1, d1htop2, d1htoq1, d1htoq2, d1htor1, d1htor2, d1htos1, d1htos2, d1htou1, d1htou2, d1htov1, d1htov2, d1htow1, d1htow2, d1htox1, d1htox2 |