SCOP 1.61: Domain d1htor2: 1hto R:101-468

Lineage for d1htor2 (1hto R:101-468)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)

4. Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families)

5. Family d.128.1.1: Glutamine synthetase, C-terminal domain [55932] (1 protein)

6. Protein Glutamine synthetase, C-terminal domain [55933] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [75542] (2 PDB entries)

8. Domain d1htor2: 1hto R:101-468 [71022]
   Other proteins in same PDB: d1htoa1, d1htob1, d1htoc1, d1htod1, d1htoe1, d1htof1, d1htog1, d1htoh1, d1htoi1, d1htoj1, d1htok1, d1htol1, d1htom1, d1hton1, d1htoo1, d1htop1, d1htoq1, d1htor1, d1htos1, d1htot1, d1htou1, d1htov1, d1htow1, d1htox1

Details for d1htor2

PDB Entry: 1hto, 2.4 Å

PDB Description: crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

SCOP Domain Sequences for d1htor2:

Sequence; same for both SEQRES and ATOM records:

>d1htor2 d.128.1.1 (R:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

Timeline for d1htor2:

• d1htor2 is new in SCOP 1.61
  
• d1htor2 appears in SCOP 1.63
  
• d1htor2 appears in the current release, SCOPe 2.08