Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily) |
Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) |
Family d.128.1.1: Glutamine synthetase, C-terminal domain [55932] (1 protein) |
Protein Glutamine synthetase, C-terminal domain [55933] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [75542] (2 PDB entries) |
Domain d1htor2: 1hto R:101-468 [71022] Other proteins in same PDB: d1htoa1, d1htob1, d1htoc1, d1htod1, d1htoe1, d1htof1, d1htog1, d1htoh1, d1htoi1, d1htoj1, d1htok1, d1htol1, d1htom1, d1hton1, d1htoo1, d1htop1, d1htoq1, d1htor1, d1htos1, d1htot1, d1htou1, d1htov1, d1htow1, d1htox1 |
PDB Entry: 1hto (more details), 2.4 Å
SCOP Domain Sequences for d1htor2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htor2 d.128.1.1 (R:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis} srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn irphpyefalyydv
Timeline for d1htor2:
View in 3D Domains from other chains: (mouse over for more information) d1htoa1, d1htoa2, d1htob1, d1htob2, d1htoc1, d1htoc2, d1htod1, d1htod2, d1htoe1, d1htoe2, d1htof1, d1htof2, d1htog1, d1htog2, d1htoh1, d1htoh2, d1htoi1, d1htoi2, d1htoj1, d1htoj2, d1htok1, d1htok2, d1htol1, d1htol2, d1htom1, d1htom2, d1hton1, d1hton2, d1htoo1, d1htoo2, d1htop1, d1htop2, d1htoq1, d1htoq2, d1htos1, d1htos2, d1htot1, d1htot2, d1htou1, d1htou2, d1htov1, d1htov2, d1htow1, d1htow2, d1htox1, d1htox2 |