Lineage for d1htoq1 (1hto Q:1-100)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1196143Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 1196144Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 1196145Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 1196146Species Mycobacterium tuberculosis [TaxId:1773] [75372] (3 PDB entries)
  8. 1196193Domain d1htoq1: 1hto Q:1-100 [71019]
    Other proteins in same PDB: d1htoa2, d1htob2, d1htoc2, d1htod2, d1htoe2, d1htof2, d1htog2, d1htoh2, d1htoi2, d1htoj2, d1htok2, d1htol2, d1htom2, d1hton2, d1htoo2, d1htop2, d1htoq2, d1htor2, d1htos2, d1htot2, d1htou2, d1htov2, d1htow2, d1htox2
    complexed with amp, cit, mn

Details for d1htoq1

PDB Entry: 1hto (more details), 2.4 Å

PDB Description: crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
PDB Compounds: (Q:) glutamine synthetase

SCOPe Domain Sequences for d1htoq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htoq1 d.15.9.1 (Q:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOPe Domain Coordinates for d1htoq1:

Click to download the PDB-style file with coordinates for d1htoq1.
(The format of our PDB-style files is described here.)

Timeline for d1htoq1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htoq2
View in 3D
Domains from other chains:
(mouse over for more information)
d1htoa1, d1htoa2, d1htob1, d1htob2, d1htoc1, d1htoc2, d1htod1, d1htod2, d1htoe1, d1htoe2, d1htof1, d1htof2, d1htog1, d1htog2, d1htoh1, d1htoh2, d1htoi1, d1htoi2, d1htoj1, d1htoj2, d1htok1, d1htok2, d1htol1, d1htol2, d1htom1, d1htom2, d1hton1, d1hton2, d1htoo1, d1htoo2, d1htop1, d1htop2, d1htor1, d1htor2, d1htos1, d1htos2, d1htot1, d1htot2, d1htou1, d1htou2, d1htov1, d1htov2, d1htow1, d1htow2, d1htox1, d1htox2