SCOP 1.61: Domain d1htop1: 1hto P:1-100

Lineage for d1htop1 (1hto P:1-100)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [75372] (2 PDB entries)

8. Domain d1htop1: 1hto P:1-100 [71017]
   Other proteins in same PDB: d1htoa2, d1htob2, d1htoc2, d1htod2, d1htoe2, d1htof2, d1htog2, d1htoh2, d1htoi2, d1htoj2, d1htok2, d1htol2, d1htom2, d1hton2, d1htoo2, d1htop2, d1htoq2, d1htor2, d1htos2, d1htot2, d1htou2, d1htov2, d1htow2, d1htox2

Details for d1htop1

PDB Entry: 1hto, 2.4 Å

PDB Description: crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

SCOP Domain Sequences for d1htop1:

Sequence; same for both SEQRES and ATOM records:

>d1htop1 d.15.9.1 (P:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

Timeline for d1htop1:

• d1htop1 is new in SCOP 1.61
  
• d1htop1 appears in SCOP 1.63
  
• d1htop1 appears in the current release, SCOPe 2.08