Lineage for d1ha7i_ (1ha7 I:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 276690Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 276715Protein Phycocyanin alpha subunit [88933] (6 species)
  7. 276725Species Spirulina platensis [TaxId:118562] [88939] (2 PDB entries)
  8. 276742Domain d1ha7i_: 1ha7 I: [70943]
    Other proteins in same PDB: d1ha7b_, d1ha7d_, d1ha7f_, d1ha7h_, d1ha7j_, d1ha7l_, d1ha7n_, d1ha7p_, d1ha7r_, d1ha7t_, d1ha7v_, d1ha7x_

Details for d1ha7i_

PDB Entry: 1ha7 (more details), 2.2 Å

PDB Description: structure of a light-harvesting phycobiliprotein, c-phycocyanin from spirulina platensis at 2.2a resolution

SCOP Domain Sequences for d1ha7i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha7i_ a.1.1.3 (I:) Phycocyanin alpha subunit {Spirulina platensis}
mktplteavsiadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
tfelspswyiealkyikanhglsgdaateansyldyainals

SCOP Domain Coordinates for d1ha7i_:

Click to download the PDB-style file with coordinates for d1ha7i_.
(The format of our PDB-style files is described here.)

Timeline for d1ha7i_: