Lineage for d1ha5d2 (1ha5 D:4108-4220)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325763Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 325764Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 325819Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 325820Species Streptococcus pyogenes [TaxId:1314] [54357] (7 PDB entries)
  8. 325834Domain d1ha5d2: 1ha5 D:4108-4220 [70934]
    Other proteins in same PDB: d1ha5a1, d1ha5b1, d1ha5c1, d1ha5d1
    complexed with zn

Details for d1ha5d2

PDB Entry: 1ha5 (more details), 2.82 Å

PDB Description: structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.

SCOP Domain Sequences for d1ha5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha5d2 d.15.6.1 (D:4108-4220) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievyltt

SCOP Domain Coordinates for d1ha5d2:

Click to download the PDB-style file with coordinates for d1ha5d2.
(The format of our PDB-style files is described here.)

Timeline for d1ha5d2: