SCOP 1.63: Domain d1ha5d1: 1ha5 D:4003-4107

Lineage for d1ha5d1 (1ha5 D:4003-4107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)

8. Domain d1ha5d1: 1ha5 D:4003-4107 [70933]
   Other proteins in same PDB: d1ha5a2, d1ha5b2, d1ha5c2, d1ha5d2
   complexed with zn

Details for d1ha5d1

PDB Entry: 1ha5, 2.82 Å

PDB Description: structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.

SCOP Domain Sequences for d1ha5d1:

Sequence; same for both SEQRES and ATOM records:

>d1ha5d1 b.40.2.2 (D:4003-4107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnha

Timeline for d1ha5d1:

• d1ha5d1 first appeared in SCOP 1.61
  
• d1ha5d1 appears in SCOP 1.65
  
• d1ha5d1 appears in the current release, SCOPe 2.08