SCOPe 2.08: Domain d1ha5c2: 1ha5 C:3108-3220

Lineage for d1ha5c2 (1ha5 C:3108-3220)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
   Uniprot P08095

8. Domain d1ha5c2: 1ha5 C:3108-3220 [70932]
   Other proteins in same PDB: d1ha5a1, d1ha5b1, d1ha5c1, d1ha5d1
   complexed with zn

Details for d1ha5c2

PDB Entry: 1ha5, 2.82 Å

PDB Description: structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.

PDB Compounds: (C:) streptococcal pyogenic exotoxin a1

SCOPe Domain Sequences for d1ha5c2:

Sequence; same for both SEQRES and ATOM records:

>d1ha5c2 d.15.6.1 (C:3108-3220) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievyltt

Timeline for d1ha5c2:

• d1ha5c2 first appeared in SCOP 1.61
  
• d1ha5c2 appears in SCOPe 2.07