Lineage for d1ha5c1 (1ha5 C:3003-3107)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949887Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)
  6. 949957Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 949958Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
    Uniprot P08095
  8. 949975Domain d1ha5c1: 1ha5 C:3003-3107 [70931]
    Other proteins in same PDB: d1ha5a2, d1ha5b2, d1ha5c2, d1ha5d2
    complexed with zn

Details for d1ha5c1

PDB Entry: 1ha5 (more details), 2.82 Å

PDB Description: structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.
PDB Compounds: (C:) streptococcal pyogenic exotoxin a1

SCOPe Domain Sequences for d1ha5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha5c1 b.40.2.2 (C:3003-3107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnha

SCOPe Domain Coordinates for d1ha5c1:

Click to download the PDB-style file with coordinates for d1ha5c1.
(The format of our PDB-style files is described here.)

Timeline for d1ha5c1: