Lineage for d1ha5b1 (1ha5 B:2003-2107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 297207Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 297262Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 297263Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)
  8. 297275Domain d1ha5b1: 1ha5 B:2003-2107 [70929]
    Other proteins in same PDB: d1ha5a2, d1ha5b2, d1ha5c2, d1ha5d2

Details for d1ha5b1

PDB Entry: 1ha5 (more details), 2.82 Å

PDB Description: structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.

SCOP Domain Sequences for d1ha5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha5b1 b.40.2.2 (B:2003-2107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnha

SCOP Domain Coordinates for d1ha5b1:

Click to download the PDB-style file with coordinates for d1ha5b1.
(The format of our PDB-style files is described here.)

Timeline for d1ha5b1: